PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_17180V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 500aa    MW: 54612.5 Da    PI: 7.2914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_17180V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161360148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W +eEde+l ++v+ +G+g+W+++ ++ g+ R++k+c++rw +yl
  Pp3c12_17180V3.1.p 13 KGAWAAEEDEKLRKYVETHGTGHWRSVGKKAGLQRCGKSCRLRWTNYL 60
                        799*******************************************97 PP

2Myb_DNA-binding54.33.1e-1767109246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g++ +eE++l+v++++ +G++ W++Ia+ m+ gRt++++k++w++
  Pp3c12_17180V3.1.p  67 GSFDPEEEDLIVKLHAAHGSR-WSLIAAQMP-GRTDNDIKNHWNT 109
                         7899*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.97860IPR017930Myb domain
SuperFamilySSF466892.72E-2911107IPR009057Homeodomain-like
SMARTSM007177.0E-131262IPR001005SANT/Myb domain
PfamPF002496.9E-151360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-231467IPR009057Homeodomain-like
CDDcd001676.35E-111560No hitNo description
PROSITE profilePS5129426.75461115IPR017930Myb domain
SMARTSM007171.5E-1565113IPR001005SANT/Myb domain
PfamPF002491.3E-1567109IPR001005SANT/Myb domain
CDDcd001677.05E-1268111No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2568115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MTRLSKSNED VRKGAWAAEE DEKLRKYVET HGTGHWRSVG KKAGLQRCGK SCRLRWTNYL  60
RPDIRHGSFD PEEEDLIVKL HAAHGSRWSL IAAQMPGRTD NDIKNHWNTR LKKKLCDMGI  120
DPVTHKPIAD LLRDLAGTMA QSTGGNNQAS EEAARRCFRD SLVSKAVREC GKNNNPAFSS  180
SQLTSHSMNI HHTDEVKSIV GDPHGANDYL GQKSSNNSGL SHSMDDSSST EETLSRRSTS  240
PPISSDLDYQ RSASGADVED PCRRFAVVSS AQMQIEANLH SRFTEASTTL PTSFLDPAGC  300
NSLTTSPLSS SGSEFLCQRK SDQTLAGPHQ LRTSYTRWLP PRNALAQEDF PNAAVQLPLS  360
RFGSEAQNQF TAQSHAESSF MQGSDVTRPQ PTAAASKLDI RINLGFNHQP ESLQENLNFG  420
YRSFGGPLMS PAATGNSLLD VSAQHALSGY AGQFPGSIIN PSNVNVASYN SPLAGATAGV  480
RLHEYEVPSP RMVLWDFQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26101154108B-MYB
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.32330.0gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S46_302V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.14e-60myb domain protein 103